Recombinant Human FGF- acidic/FGF1
Recombinant (E. coli)
Lyophilizate, sterile-filtered
Cat.No. RP1003 10 μg store at -20 ℃
Synonyms : Fibroblast Growth Factor-acidic, FGF-1, HBGF-1, ECGF-beta, FGF-a
Description: Human Recombinant Fibroblast Growth Factor-1 (FGF-1) produced in E.coli is a single, non-glycosylated, polypeptide chain containing 155 amino acids and having a molecular mass of 17460 Dalton.
Source: Escherichia coli.
Purity: Greater than 95.0% as determined by SDS-PAGE.
Endotoxin Level: Endotoxin level is less than 0.1 ng per μg (1EU/μg) as determined by the LAL method.
Biological Activity: The ED50, calculated by the dose-dependent proliferation of mouse BALB/c 3T3 cells is <1.0 ng/ml, corresponding to a Specific Activity of 1 x 1,000,000 IU/mg.
Amino acid sequence:
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Formulation & Storage: It was lyophilized from sterile 10 mM sodium phosphate ( pH 7.4) and we recommend that the powder be reconstituted in sterile 10 mcm H2O. Upon reconstitution aFGF should be stored at 4°C. For long-term storage at -20°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Freeze-thaw cycles should be avoided.
Usage: The product is for research only and may not be allowed for usage as drugs, agricultural or pesticidal products, food additives or household chemicals.