Recombinant Human Epidermal Growth Factor/ human EGF
Recombinant (E .coli)
Sterile-filtered
Cat.No. RP-1006 100 μg store at -20℃
Synonyms: Urogastrone, URG, EGF.
Description: Human Recombinant Epidermal Growth Factor (EGF) produced in E.coli is a single, non-glycosylated, polypeptide chain containing 53 amino acids fragment and having a molecular weight of 6.2kDa and fused with a 1.4kDa amino-terminal hexahistidine tag.
Source: Escherichia coli.
Purity: Greater than 95.0% as determined by SDS-PAGE.
Endotoxin Level : Endotoxin level is less than 0.1 ng per μg (1EU/μg) as determined by the LAL method.
Biological Activity : The ED50, calculated by the dose-dependent proliferation of murine BALB/c 3T3 cells (measured by 3H-thymidine uptake) is < 0.1 ng/ml corresponding to a specific activity of 1 x 10,000,000 Units/mg.
Amino acid sequence:
MRGSHHHHHHGSNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Formulation & storage: It was lyophilized from sterile 10 mM sodium phosphate ( pH 7.4) and we recommend that the powder be reconstituted in sterile 10 mcm H2O. Upon reconstitution, EGF should be stored at 4°C. For long-term storage at -20°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Freeze-thaw cycles should be avoided.
Usage: The product is for research only and may not be allowed for usage as drugs, agricultural or pesticidal products, food additives or household chemicals.