Recombinant Human FGF-basic/FGF2
Recombinant (E.coli)
Lyophilizate, sterile-filtered
Cat.No. RP1002 10 μg store at -20 ℃
Synonyms : Fibroblast Growth Factor-basic, FGF-2, HBGF-2, HBGH-2, FGF-b, Prostatropin
Description: Fibroblast Growth Factor-2 Human Recombinant (FGF-2) produced in E.coli is a single, non-glycosylated, polypeptide chain containing 157 amino acids and having a molecular mass of 17397 Dalton.
Source: Escherichia coli.
Purity: Greater than 95.0% as determined by SDS-PAGE.
Endotoxin Level: Endotoxin level is less than 0.1 ng per μg (1EU/μg) as determined by the LAL method.
Biological Activity: The ED50, measured in a mitogenic assay using quiescent NR6R-3T3 fibroblasts was found to be less than 0.1 ng/ml, corresponding to a specific activity of 3 x 106 Units/mg.
Amino acid sequence: GSMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Formulation & storage: It was lyophilized from sterile 10 mM sodium phosphate (pH7.4) and we recommend that the powder be reconstituted in sterile 10 mcm H2O. Upon reconstitution, FGF2 should be stored at 4°C. For long- term storage at -20°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Freeze-thaw cycles should be avoided.
Usage: The product is for research only and may not be allowed for usage as drugs, agricultural or pesticidal products, food additives or household chemicals.